Proteintech, 10566-1-AP, GYS1 Polyclonal antibody

Size: 20ul / 150ul The GYS1 (10566-1-AP) by Proteintech is a Polyclonal antibody targeting GYS1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10566-1-AP targets GYS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, Jurkat cells, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue Positive IHC detected in: human liver tissue, human skeletal muscle tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GYS1(Glycogen [starch] synthase, muscle) is the the rate limiting enzyme of the insulin-induced glycogenesis, transferring glucose units from UDP-Glc to a glycogen primer. It catalyzes the linear addition of glucose residues to the branching structure of glycogen, providing a convenient store of glucose for times of metabolic need. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0857 Product name: Recombinant human GYS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-737 aa of BC007688 Sequence: RAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN Predict reactive species Full Name: glycogen synthase 1 (muscle) Calculated Molecular Weight: 84 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC007688 Gene Symbol: GYS1 Gene ID (NCBI): 2997 RRID: AB_2116401 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13807 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.