Proteintech, 10662-1-AP, SULT1C2 Polyclonal antibody

Size: 20ul / 150ul The SULT1C2 (10662-1-AP) by Proteintech is a Polyclonal antibody targeting SULT1C2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10662-1-AP targets SULT1C2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human stomach tissue, human kidney tissue, human liver tissue, mouse liver tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SULT1C2, also named as SULT1C1, ST1C2, ST1C1, and humSULTC2, belongs to the sulfotransferase 1 family. It is a sulfotransferase enzymes that catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. SULT1C2 may be involved in the activation of carcinogenic hyroxylamines. It is responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1064 Product name: Recombinant human SULT1C2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-296 aa of BC005353 Sequence: MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL Predict reactive species Full Name: sulfotransferase family, cytosolic, 1C, member 2 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC005353 Gene Symbol: SULT1C2 Gene ID (NCBI): 6819 RRID: AB_2197745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00338 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.