Proteintech, 10697-1-AP, RCC1 Polyclonal antibody

Size: 20ul / 150ul The RCC1 (10697-1-AP) by Proteintech is a Polyclonal antibody targeting RCC1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 10697-1-AP targets RCC1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, Jurkat cells, mouse testis tissue, Raji cells, SGC-7901 cells, HeLa cells, HEK-293 cells, HEK-293T cells Positive IP detected in: HeLa cells Positive IHC detected in: human ovary tumor tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CHC1, also named as RCC1, SNHG3-RCC1, promotes the exchange of ran-bound gdp by gtp. It is involved in the regulation of onset of chromosome condensation in the S-phase. Phosphorylation of RCC1 on serines located in or near its nuclear localization signal activates RCC1 to generate RanGTP on mitotic chromosomes, which is required for spindle assembly and chromosome segregation. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human RCC1. The geneID has updated as 1104 recently. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1042 Product name: Recombinant human SNHG3-RCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-421 aa of BC007300 Sequence: KVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Predict reactive species Full Name: regulator of chromosome condensation 1 Calculated Molecular Weight: 45 kDa, 48 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC007300 Gene Symbol: RCC1 Gene ID (NCBI): 1104 RRID: AB_513962 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18754 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.