Iright
BRAND / VENDOR: Proteintech

Proteintech, 10752-1-AP, CNOT8 Polyclonal antibody

CATALOG NUMBER: 10752-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CNOT8 (10752-1-AP) by Proteintech is a Polyclonal antibody targeting CNOT8 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10752-1-AP targets CNOT8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human prostate cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CCR4-NOT transcription complex subunit 8(CNOT8), is a ubiquitous transcription factor, which required for a diverse set of processes. The CCR4-NOT complex is a global regulator of RNA polymerase II, and functions as general transcription regulation complex. It consisted part by CCR4, NOT1 to NOT5, and CAF1. This is a rabbit polyclonal antibody raised against the full-length chain of human CNOT8. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1201 Product name: Recombinant human CNOT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC017366 Sequence: MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ Predict reactive species Full Name: CCR4-NOT transcription complex, subunit 8 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC017366 Gene Symbol: CNOT8 Gene ID (NCBI): 9337 RRID: AB_2082470 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UFF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924