Proteintech, 10802-1-AP, Geminin Polyclonal antibody

Size: 20ul / 150ul The Geminin (10802-1-AP) by Proteintech is a Polyclonal antibody targeting Geminin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10802-1-AP targets Geminin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human testis tissue, mouse testis tissue, HeLa cells; mouse testis tissue, rat testis tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in inhibiting DNA replication by preventing the incorporation of MCM complex into the pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to the apparent mass of 42.5 kDa and 66 kDa are present. The dimer of geminin(50 kDa) can also be detected. (PMID: 15313623) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1076 Product name: Recombinant human GMNN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC005185 Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI Predict reactive species Full Name: geminin, DNA replication inhibitor Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 28-29 kDa GenBank Accession Number: BC005185 Gene Symbol: GMNN Gene ID (NCBI): 51053 RRID: AB_2110945 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75496 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.