Proteintech, 10818-1-AP, ERCC2 Polyclonal antibody

Size: 20ul / 150ul The ERCC2 (10818-1-AP) by Proteintech is a Polyclonal antibody targeting ERCC2 in WB, IP, IHC, ELISA applications with reactivity to human samples 10818-1-AP targets ERCC2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, HEK-293 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human lymphoma tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Excision-repair complementing defective in Chinese hamster 2(ERCC2), belongs to the nucleotide excision repair pathway, is a component of the TFIIH transcription complex and required for the association of the CDK-activating kinase(CAK) subcomplex with TFIIH. Since TFIIH is involved in both DNA repair and cell cycle progression, ERCC2 is implicated to play an integral role in the nucleotide excision repair pathway. Also it involves in the regulation of vitamin-D receptor activity. As a part of the mitotic spindle-associated MMXD complex, ERCC2 has a role in chromosome segregation. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1038 Product name: Recombinant human ERCC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC008346 Sequence: MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRT Predict reactive species Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 2 Calculated Molecular Weight: 87 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC008346 Gene Symbol: ERCC2 Gene ID (NCBI): 2068 RRID: AB_2231330 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18074 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.