Proteintech, 10832-1-AP, BMI1 Polyclonal antibody

Size: 20ul / 150ul The BMI1 (10832-1-AP) by Proteintech is a Polyclonal antibody targeting BMI1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10832-1-AP targets BMI1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, A549 cells, HEK-293 cells, Calu-1 cells, HeLa cells, K-562 cells, U-937 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IP detected in: HT-29 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information BMI- 1 is one of polycomb group genes, which together with Ring1 strongly enhances the E3 ubiquitin ligase activity of the Ring2 catalytic subunit. Bmi1 plays an important role in the regulation of cell proliferation and senescence through repression of the p16Ink4a and p19Arf genes and is required for maintenance of adult hematopoietic and neural stem cells. The antibody 10832-1-AP detected proteins of 45-48kda, which may include phosphorylated isoforms of the protein. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1286 Product name: Recombinant human BMI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC011652 Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG Predict reactive species Full Name: BMI1 polycomb ring finger oncogene Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37-43 kDa GenBank Accession Number: BC011652 Gene Symbol: BMI1 Gene ID (NCBI): 648 RRID: AB_2065392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35226 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.