Proteintech, 10856-1-AP, Histone H2A.X Polyclonal antibody

Size: 20ul / 150ul The Histone H2A 10856-1-AP targets Histone H2A.X in WB, IHC, IF/ICC, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HL-60 cells, HEK-293 ells, mouse heart, mouse kidney, rat kidney Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, U-251 cells, U2OS cells Positive ChIP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Chromatin immunoprecipitation (ChIP): CHIP : 1:10-1:100 Background Information Histone H2A.X belongs to the histone H2A family, which is synthesized in G1 and S phase. It is involved in nucleosomal organization of chromatin together with other histone proteins, and is specially important for recombination between immunoglobulin switch regions. H2A.X becomes phosphorylated on serine 139 (to form gamma-H2AFX or H2AX139ph) in response to DNA double strand breaks (DSBs) generated by exogenous genotoxic agents and by stalled replication forks, which promotes DNA repair and maintains genomic stability. The calculated molecular weight of H2AX is 15 kDa, but the ubiquitinated H2A.X is about 22 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1305 Product name: Recombinant human Histone H2A.X protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-143 aa of BC013416 Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY Predict reactive species Full Name: H2A histone family, member X Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15-18 kDa GenBank Accession Number: BC013416 Gene Symbol: Histone H2A.X Gene ID (NCBI): 3014 RRID: AB_2114985 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.