Iright
BRAND / VENDOR: Proteintech

Proteintech, 10858-1-AP, Timp-3 Polyclonal antibody

CATALOG NUMBER: 10858-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Timp-3 (10858-1-AP) by Proteintech is a Polyclonal antibody targeting Timp-3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10858-1-AP targets Timp-3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Timp-3 (TIMP metallopeptidase inhibitor 3), also known as SFD. It is expected to be located in extracellular space, and the protein is enriched in the placenta tissue and fat tissue. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation, and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. TIMP-3 is expressed as an unglycosylated 24 kDa and glycosylated 29 kDa protein with inhibitory activity against interstitial collagenase, stromelysin-1, and gelatinases A and B (PMID:11827795). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1253 Product name: Recombinant human Timp-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC014277 Sequence: MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP Predict reactive species Full Name: TIMP metallopeptidase inhibitor 3 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 20-30 kDa GenBank Accession Number: BC014277 Gene Symbol: TIMP3 Gene ID (NCBI): 7078 RRID: AB_2204973 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924