Proteintech, 10939-1-AP, FGF-7/KGF Polyclonal antibody

Size: 20ul / 150ul The FGF-7/KGF (10939-1-AP) by Proteintech is a Polyclonal antibody targeting FGF-7/KGF in WB, ELISA applications with reactivity to human, mouse samples 10939-1-AP targets FGF-7/KGF in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Fibroblast growth factor 7 (FGF7), also called keratinocyte growth factor, is a member of the FGF superfamily, which has been reported to stimulate cell proliferation, differentiation, migration, and vascular angiogenesis. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1372 Product name: Recombinant human FGF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC010956 Sequence: MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGEDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYSK Predict reactive species Full Name: fibroblast growth factor 7 (keratinocyte growth factor) Calculated Molecular Weight: 22-28 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC010956 Gene Symbol: FGF7 Gene ID (NCBI): 2252 RRID: AB_2102816 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21781 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.