Proteintech, 10976-4-AP, STXBP6 Polyclonal antibody

Size: 20ul / 150ul The STXBP6 (10976-4-AP) by Proteintech is a Polyclonal antibody targeting STXBP6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10976-4-AP targets STXBP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human heart tissue, human brain tissue, BxPC-3 cells, rat brain tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1427 Product name: Recombinant human STXBP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC009499 Sequence: MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLKNSAQQFAETAHKLAMKHKC Predict reactive species Full Name: syntaxin binding protein 6 (amisyn) Calculated Molecular Weight: 25 kDa or 45 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC009499 Gene Symbol: STXBP6 Gene ID (NCBI): 29091 RRID: AB_2197002 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.