Proteintech, 10988-1-AP, BID Polyclonal antibody

Size: 20ul / 150ul The BID (10988-1-AP) by Proteintech is a Polyclonal antibody targeting BID in WB, IP, ELISA applications with reactivity to human samples 10988-1-AP targets BID in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, human brain tissue, Tunicamycin treated HeLa cells, A549 cells, HEK-293 cells, HepG2 cells, Jurkat cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information BID, also named as p22 BID, can be cleaved into p11 BID, p13 BID and p15 BID. It is pro-apoptotic molecules. The major proteolytic product p15 BID allows the release of cytochrome c. BID-L, BID-EL and BID-ES induce ICE-like proteases and apoptosis. BID-S does not induce apoptosis. BID counters the protective effect of Bcl-2. (PMID:14583606) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1445 Product name: Recombinant human BID protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-195 aa of BC009197 Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD Predict reactive species Full Name: BH3 interacting domain death agonist Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC009197 Gene Symbol: BID Gene ID (NCBI): 637 RRID: AB_2065624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55957 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.