Proteintech, 11067-2-AP, PROX1 Polyclonal antibody

Size: 20ul / 150ul The PROX1 (11067-2-AP) by Proteintech is a Polyclonal antibody targeting PROX1 in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 11067-2-AP targets PROX1 in WB, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, human liver tissue, MCF-7 cells, HuH-7 cells Positive IP detected in: HepG2 cells Positive IF/ICC detected in: HuH-7 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Prospero-related homeobox 1 (Prox1) is a homeobox transcription factor involved in various developmental processes, including neurogenesis and lymphangiogenesis. In the central nervous system (CNS), it controls the maintenance, proliferation, and differentiation of neural stem cells. This is a rabbit polyclonal antibody raised against part of C-terminal chain of human PROX1. The calcualted molecular weight of PROX1 is 83 kDa.What is the molecular weight of KEAP1 protein? Is Prox1 post-translationally modified?The calculated molecular weight of Prox1 protein is 83 kDa but the observed weight is 95 kDa. Prox1 is a subject of SUMO-ylation at K556, which is important for its transcription activity and increases the molecular weight of Prox1 to 110 kDa (PMID: 19706680). Usually there is a pool of modified and unmodified Prox1 protein in cells and therefore it is quite common to observe two specific bands in western blotting using Prox1 antibody.What is the subcellular localization of Prox1?Prox1 contains a nuclear localization signal within its N-terminus and resides in the nucleus, where it acts as a transcription factor.What is the tissue expression pattern of Prox1 in the central nervous system?Prox1 expression in the central nervous system (CNS) depends on the developmental stage. During embryogenesis Prox1 is present in neuronal precursors located in the subventricular zone, while during fetal development it is additionally present in the cerebral and cerebellar cortex and hippocampus. Postnatally, Prox1 expression in the CNS is restricted to the dentate gyrus of the hippocampus and cerebellum (PMID: 17117441). Therefore, Prox1 can be used as a marker of a subset of neuronal progenitors, as well as a specific marker of dentate gyrus cell lineage, such as type-2 intermediate progenitors and mature granule cells.Is Prox1 expressed outside of the central nervous system?Yes. Prox1 is expressed in the developmental stages of the eye lens, liver, pancreas, heart, and the lymphatic system (PMID: 22733308). Prox1 is also expressed post-developmentally in lymphatic endothelial cells and is often used, together with VEGFR-3, as a marker for lymphatic vessels. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1543 Product name: Recombinant human PROX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-736 aa of BC024201 Sequence: TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH Predict reactive species Full Name: prospero homeobox 1 Calculated Molecular Weight: 737 aa, 83 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC024201 Gene Symbol: PROX1 Gene ID (NCBI): 5629 RRID: AB_2268804 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92786 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.