Proteintech, 11069-2-AP, FMR1NB Polyclonal antibody

Size: 20ul / 150ul The FMR1NB (11069-2-AP) by Proteintech is a Polyclonal antibody targeting FMR1NB in WB, IHC, ELISA applications with reactivity to human, mouse samples 11069-2-AP targets FMR1NB in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF7 cells, A549 cells, MCF-7 cells, SKOV-3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1531 Product name: Recombinant human FMR1NB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-186 aa of BC034320 Sequence: CSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQ Predict reactive species Full Name: fragile X mental retardation 1 neighbor Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC034320 Gene Symbol: FMR1NB Gene ID (NCBI): 158521 RRID: AB_2105567 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N0W7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.