Iright
BRAND / VENDOR: Proteintech

Proteintech, 11101-1-AP, Rab23 Polyclonal antibody

CATALOG NUMBER: 11101-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Rab23 (11101-1-AP) by Proteintech is a Polyclonal antibody targeting Rab23 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11101-1-AP targets Rab23 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, HEK-293 cells, human brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Rab23 is a novel member of large Rab small GTPase family. It plays important roles during embryonic development. The brain-enriched Rab23 is the only Rab protein that is known to have a distinct function during central nervous system development, playing an essential role as a negative regulator of the Sonic Hedgehog (Shh) pathway. RAB23 has recently been identified in mesangial cells (MCs), and could serve as a biomarker that indicates the severity of FSGS ( focal segmental glomerulosclerosis). Mutations in RAB23 may result in ACPS2 ( acrocephalopolysyndactyly type 2). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1588 Product name: Recombinant human RAB23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC015021 Sequence: MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSG Predict reactive species Full Name: RAB23, member RAS oncogene family Calculated Molecular Weight: 237 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC015021 Gene Symbol: RAB23 Gene ID (NCBI): 51715 RRID: AB_2173784 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924