Proteintech, 11144-1-AP, P2RX7 Polyclonal antibody

Size: 20ul / 150ul The P2RX7 (11144-1-AP) by Proteintech is a Polyclonal antibody targeting P2RX7 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 11144-1-AP targets P2RX7 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue Positive FC (Intra) detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs) (PMID: 21724990). P2RX7 functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. P2RX7 is highly expressed by cells of the haemopoietic lineage and can mediate cell death, killing of infectious organisms, and regulation of the inflammatory response (PMID: 22102807). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1600 Product name: Recombinant human P2RX7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 246-595 aa of BC011913 Sequence: AIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY Predict reactive species Full Name: purinergic receptor P2X, ligand-gated ion channel, 7 Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC011913 Gene Symbol: P2RX7 Gene ID (NCBI): 5027 RRID: AB_2158371 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99572 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.