Proteintech, 11156-1-AP, SMARCD2 Polyclonal antibody

Size: 20ul / 150ul The SMARCD2 (11156-1-AP) by Proteintech is a Polyclonal antibody targeting SMARCD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11156-1-AP targets SMARCD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, RAW264.7 cells Positive IHC detected in: mouse spleen tissue, human cervical cancer tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The SWI/SNF chromatin remodelling complexes are important regulators of transcription; they consist of large multisubunit assemblies containing either Brm or Brg1 as the catalytic ATPase subunit and a variable subset of approximately 10 Brg/Brm-associated factors (BAF) [PMID:20148946]. SMARCD2 is one of BAF60 proteins, which are found in most complexes, is thought to bridge interactions between transcription factors and SWI/SNF complexes. [PMID:9427560] Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1630 Product name: Recombinant human SMARCD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC018953 Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT Predict reactive species Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC018953 Gene Symbol: SMARCD2 Gene ID (NCBI): 6603 RRID: AB_2192145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92925 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.