Proteintech, 11262-2-AP, ATG3 Polyclonal antibody

Size: 20ul / 150ul The ATG3 (11262-2-AP) by Proteintech is a Polyclonal antibody targeting ATG3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11262-2-AP targets ATG3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, Jurkat cells, K-562 cells, THP-1 cells, PC-12 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Autophagy is a lysosome-dependent conserved catabolic process in response to various stresses, such as oxidative stress and ischemia, for the degradation and recycling of aged or dysfunctional intracellular components and damaged organelles. A large group of autophagy-related genes (ATGs) have been identifed as essential drivers in diferent stages of autophagy. Autophagy-related 3 (ATG3), one of the autophagyrelated gene family members, serves as an E2-like enzyme contributing to the conjugation of microtubule-associated protein light chain 3 (LC3) to lipid phosphotidylethanolamine (PE). ATG3 plays a signifcant role in the regulation of autophagy, viability, and death. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1785 Product name: Recombinant human ATG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC024221 Sequence: MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM Predict reactive species Full Name: ATG3 autophagy related 3 homolog (S. cerevisiae) Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC024221 Gene Symbol: ATG3 Gene ID (NCBI): 64422 RRID: AB_2059234 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NT62 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.