Proteintech, 11275-1-AP, CREB3 Polyclonal antibody

Size: 20ul / 150ul The CREB3 (11275-1-AP) by Proteintech is a Polyclonal antibody targeting CREB3 in WB, IF/ICC, ELISA applications with reactivity to human samples 11275-1-AP targets CREB3 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CREB3, also named as LZIP and Luman, belongs to the bZIP family and ATF subfamily. It is a transcription factors activated upon intramembrane proteolysis (RIP), binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. CREB3 binds to and requires HCFC1 as a coactivator. The activity and expression are suppressed when the HCFC1-CREB3 complex binds with CREBZF. Participates in LKN-1/CCL15-induced chemotaxis signaling. CREB3 is N-glycosylated and released by proteolysis. So the MW of CREB3 emirate 40kd to 64kd (PMID: 12138176). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1823 Product name: Recombinant human CREB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-371 aa of BC009402 Sequence: MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG Predict reactive species Full Name: cAMP responsive element binding protein 3 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 40-64 kDa GenBank Accession Number: BC009402 Gene Symbol: CREB3 Gene ID (NCBI): 10488 RRID: AB_10640533 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43889 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.