Proteintech, 11283-1-AP, TMPRSS4 Polyclonal antibody

Size: 20ul / 150ul The TMPRSS4 (11283-1-AP) by Proteintech is a Polyclonal antibody targeting TMPRSS4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11283-1-AP targets TMPRSS4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, BxPC-3 cells Positive IHC detected in: human pancreas cancer tissue, human colon tissue, human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information TMPRSS4, also named as CAPH2 and MT-SP2, belongs to the peptidase S1 family. TMPRSS4 is a novel type II transmembrane serine protease that is highly expressed on the cell surface in pancreatic, thyroid and other cancer tissues. It promotes invasion, migration and metastasis of human tumor cells by facilitating an epithelial-mesenchymal transition(EMT)(PMID:20118200). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1804 Product name: Recombinant human TMPRSS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-437 aa of BC011703 Sequence: PRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL Predict reactive species Full Name: transmembrane protease, serine 4 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC011703 Gene Symbol: TMPRSS4 Gene ID (NCBI): 56649 RRID: AB_2203508 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRS4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.