Iright
BRAND / VENDOR: Proteintech

Proteintech, 11298-1-AP, HLA-DPB1 Polyclonal antibody

CATALOG NUMBER: 11298-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HLA-DPB1 (11298-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DPB1 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 11298-1-AP targets HLA-DPB1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells Positive IHC detected in: human tonsillitis tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1815 Product name: Recombinant human HLA-DPB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC015000 Sequence: MVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA Predict reactive species Full Name: major histocompatibility complex, class II, DP beta 1 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC015000 Gene Symbol: HLA-DPB1 Gene ID (NCBI): 3115 RRID: AB_2877755 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924