Proteintech, 11416-1-AP, COX7A2L Polyclonal antibody

Size: 20ul / 150ul The COX7A2L (11416-1-AP) by Proteintech is a Polyclonal antibody targeting COX7A2L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11416-1-AP targets COX7A2L in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human ovary tumor tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Cytochrome c oxidase (COX) is the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. The mitochondrially encoded subunits function in electron transfer, and the nuclear encoded subunits may function in the regulation and assembly of the complex. COX7A2L (cytochrome c oxidase subunit 7A-related protein), also known as COX7AR or COX7RP, is an inner mitochondrial membrane protein. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. Recently it was found that DNA methylation of COX7A2L had a significant association with therapy response in patients with breast cancer. In Alzheimer's disease the expression of COX7A2L was reduced. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1980 Product name: Recombinant human COX7A2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC007095 Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK Predict reactive species Full Name: cytochrome c oxidase subunit VIIa polypeptide 2 like Calculated Molecular Weight: 114 aa, 13 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC007095 Gene Symbol: COX7A2L Gene ID (NCBI): 9167 RRID: AB_2245402 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14548 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.