Proteintech, 11622-1-AP, DOCK8 Polyclonal antibody

Size: 20ul / 150ul The DOCK8 (11622-1-AP) by Proteintech is a Polyclonal antibody targeting DOCK8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11622-1-AP targets DOCK8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, rat lung tissue, THP-1 cells Positive IHC detected in: rat lung tissue, human heart tissue, mouse kidney tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BackgroundDedicator of Cytokinesis 8 (DOCK8) is a protein that regulates the actin cytoskeleton, with particular importance in immune cells and a key role in innate and adaptive immune responses.What is the molecular weight of DOCK8?231 kDa. DOCK8 is a protein composed of 2031 amino acids and is a guanine nucleotide exchange factor (GEF).What is the function of DOCK8?DOCK8 is a member of the DOCK family of proteins, which have a unique DRH2 domain enabling them to act as GEFs and so controlling a range of cellular processes in various signaling pathways (PMID: 12432077). The specific target of DOCK8 is Cell division control protein 42 homolog (Cdc42), a small GTPase that is involved in regulation of the cell cycle and forms a complex. DOCK8 also acts as a scaffold molecule in this complex that initiates actin polymerization via the Wiskott-Aldrich Syndrome protein (WASp) (PubMed: 28028151, PubMed: 22461490).What diseases are associated with DOCK8?The role of DOCK8 in immunity was first identified with the study of DOCK8-deficient patients who presented with combined immunodeficiency (PMID: 19776401; PMID: 20004785). The subsequent study of DOCK8 in immune cells such as T cells, natural killer (NK) cells, and B cells has revealed how it regulates their normal function. This includes the regulation of immune synapse formation, immune cell trafficking, regulation of dendritic cell polarization, and cytokine production (PMID: 28366940).DOCK8 deficiency is caused by a number of different mutations in the gene. It leads to the autosomal recessive form of the immunodeficiency disease Hyper-IgE syndrome, or Job's syndrome. The symptoms of DOCK8 deficiency include eczema, high levels of serum IgE, hypereosinophilia, and recurrent respiratory and skin infections as a result of impaired immune cell function. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2040 Product name: Recombinant human DOCK8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 257-606 aa of BC019102 Sequence: EVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFFGSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS Predict reactive species Full Name: dedicator of cytokinesis 8 Calculated Molecular Weight: 2031 aa, 231 kDa Observed Molecular Weight: 230-239 kDa GenBank Accession Number: BC019102 Gene Symbol: DOCK8 Gene ID (NCBI): 81704 RRID: AB_10216360 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NF50 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.