Proteintech, 11650-2-AP, CBX3 Polyclonal antibody

Size: 20ul / 150ul The CBX3 (11650-2-AP) by Proteintech is a Polyclonal antibody targeting CBX3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11650-2-AP targets CBX3 in WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, mouse spleen tissue, RAW 264.7 cells, rat spleen tissue Positive IP detected in: mouse spleen tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The family of Heterochromatin protein 1 (HP1) proteins is a family of highly conserved heterochromatin-associated non-histone chromosomal proteins , which has important functions in nucleus. These functions include gene activation or repression, regulation of binding of cohesion complexes to centromere, sequestration of genes to nuclear periphery, and heterochromatin formation and propagation. Much evidence shows that HP1 proteins interact with numerous proteins including methylated histones, histone methyltransferases and so on. CBX3 is one of the paralogues of HP1 proteins Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2251 Product name: Recombinant human CBX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC000954 Sequence: MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ Predict reactive species Full Name: chromobox homolog 3 (HP1 gamma homolog, Drosophila) Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC000954 Gene Symbol: CBX3 Gene ID (NCBI): 11335 RRID: AB_2071136 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13185 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.