Proteintech, 11669-1-AP, MOBKL1B Polyclonal antibody

Size: 20ul / 150ul The MOBKL1B (11669-1-AP) by Proteintech is a Polyclonal antibody targeting MOBKL1B in WB, ELISA applications with reactivity to human, mouse samples 11669-1-AP targets MOBKL1B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, A375 cells, mouse liver tissue, Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2252 Product name: Recombinant human MOBKL1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC003398 Sequence: MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR Predict reactive species Full Name: MOB1, Mps One Binder kinase activator-like 1B (yeast) Calculated Molecular Weight: 216 aa, 25 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC003398 Gene Symbol: MOBKL1B Gene ID (NCBI): 55233 RRID: AB_10597231 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H8S9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.