Proteintech, 11705-1-AP, CDK9 Polyclonal antibody

Size: 20ul / 150ul The CDK9 (11705-1-AP) by Proteintech is a Polyclonal antibody targeting CDK9 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 11705-1-AP targets CDK9 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human placenta tissue, Jurkat cells, NIH/3T3 cells Positive IHC detected in: human gliomas tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, U2OS cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2318 Product name: Recombinant human CDK9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-372 aa of BC001968 Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF Predict reactive species Full Name: cyclin-dependent kinase 9 Calculated Molecular Weight: 372 aa, 43 kDa Observed Molecular Weight: 38-42 kDa, 55 kDa GenBank Accession Number: BC001968 Gene Symbol: CDK9 Gene ID (NCBI): 1025 RRID: AB_2077302 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50750 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.