Iright
BRAND / VENDOR: Proteintech

Proteintech, 11711-1-AP, GAR1 Polyclonal antibody

CATALOG NUMBER: 11711-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GAR1 (11711-1-AP) by Proteintech is a Polyclonal antibody targeting GAR1 in WB, IHC, IP, ELISA applications with reactivity to human samples 11711-1-AP targets GAR1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information GAR1, other named NOLA1, is a subunit of H/ACA and telomerase. Thought is not required for H/ACA protein assembly, GAR1 is necessary for ribosome biogenesis and telomere. H/ACA involves in class specify the sites of uridine-to-pseudouridine. It contains a core domain that flanked by glycine- and arginine-rich(GAR) domains. GAR1 also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transciptase(TERT) holoenzyme. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2282 Product name: Recombinant human GAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC003413 Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH Predict reactive species Full Name: GAR1 ribonucleoprotein homolog (yeast) Calculated Molecular Weight: 217 aa, 22 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC003413 Gene Symbol: GAR1 Gene ID (NCBI): 54433 RRID: AB_2081845 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924