Proteintech, 11717-1-AP, RHOD Polyclonal antibody

Size: 20ul / 150ul The RHOD (11717-1-AP) by Proteintech is a Polyclonal antibody targeting RHOD in IF, IHC, ELISA applications with reactivity to human samples 11717-1-AP targets RHOD in IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF detected in: Human Retina Whole Mount Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF): IF : 1:10-1:100 Background Information RhoD is a member of the Rho family of small GTPases, and it has been implicated in integrating actin reorganization and endosome motility. RhoD localizes to early endosomes and recycling endosomes, which indicates its important role in the regulation of endosome trafficking. It is involved in reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2291 Product name: Recombinant human RHOD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC001338 Sequence: MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT Predict reactive species Full Name: ras homolog gene family, member D Calculated Molecular Weight: 210 aa, 23 kDa GenBank Accession Number: BC001338 Gene Symbol: RHOD Gene ID (NCBI): 29984 RRID: AB_2877789 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00212 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.