Proteintech, 11743-1-AP, PKIA Polyclonal antibody

Size: 20ul / 150ul The PKIA (11743-1-AP) by Proteintech is a Polyclonal antibody targeting PKIA in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11743-1-AP targets PKIA in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse embryo tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information cAMP-dependent protein kinase inhibitor alpha (PKIA) is also named as PRKACN1, and belongs to the PKI family. Among them, PKIA, a member of protein kinase A (PKA) inhibitor family, was found to be most significantly and highly expressed in susceptible animals (PMID:24910983). Decreased PKIA signaling would directly impact PKA activation, potentially inducing DRP1 phosphorylation and increasing ER Ca2+ stores (PMID:32152556). miR-129-5p activated PKA to regulate the phosphorylation of beta-catenin and cAMP-response element binding protein (CREB) by inhibiting PKIA (PMID:36222334). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2338 Product name: Recombinant human PKIA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC022265 Sequence: MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES Predict reactive species Full Name: protein kinase (cAMP-dependent, catalytic) inhibitor alpha Calculated Molecular Weight: 76 aa, 8 kDa GenBank Accession Number: BC022265 Gene Symbol: PKIA Gene ID (NCBI): 5569 RRID: AB_3085380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61925 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.