Proteintech, 11746-1-AP, HBP1 Polyclonal antibody

Size: 20ul / 150ul The HBP1 (11746-1-AP) by Proteintech is a Polyclonal antibody targeting HBP1 in WB, IP, ELISA applications with reactivity to human, mouse samples 11746-1-AP targets HBP1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human brain tissue, SGC-7901 cells Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information HMG-box protein 1 (HBP1) is a transcriptional repressor, and has a role in cell cycle progression and tumor suppression. Also it's a repressor of the cyclin D1 gene and inhibits the Wnt signaling pathway. Interaction with RB1 enhances it's binding to the H1F0 promoter . Disrupts the interaction between DNA and TCF4. This is a rabbit polyclonal antibody raised against part of C-terminus of HBP1 of human origin. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2342 Product name: Recombinant human HBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 215-514 aa of BC022329 Sequence: FLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDPGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH Predict reactive species Full Name: HMG-box transcription factor 1 Calculated Molecular Weight: 514 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC022329 Gene Symbol: HBP1 Gene ID (NCBI): 26959 RRID: AB_2247970 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60381 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.