Proteintech, 11778-1-AP, VWF, VWFpp Polyclonal antibody

Size: 20ul / 150ul The VWF, VWFpp (11778-1-AP) by Proteintech is a Polyclonal antibody targeting VWF, VWFpp in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 11778-1-AP targets VWF, VWFpp in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, Jurkat cells, human placenta tissue, mouse spleen tissue, rat spleen tissue Positive IP detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Von Willebrand factor (vWF) is a large multimeric glycoprotein that is crucial to the hemostasis process. It supports platelet adhesion and carries factor VIII (FVIII). Deficiency of vWF results in von Willebrand disease (vWD), a common inherited bleeding disorder. The pre-pro-vWF is comprised of 2,813 amino acids (aa) which encompass a 22-aa signal peptide, a 741-aa large propeptide (vWF propeptide, vWFpp, also called von Willebrand antigen 2) and 2,050 aa making up the mature vWF. The von Willebrand antigen 2 is required for multimerization of vWF and for its targeting to storage granules. This antibody raised against the N-terminal region of pre-pro-vWF recognizes von Willebrand antigen 2 (75-100 kDa) and pro-vWF (309-320 kDa). (PMID: 9759493; 12067899; 22452980; 8874191) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2386 Product name: Recombinant human VWF, VWFpp protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of . Sequence: MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSPRAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKVGVDWPGCTWMVCDFWI Predict reactive species Full Name: von Willebrand factor Calculated Molecular Weight: 309 kDa Observed Molecular Weight: 309-320 kDa, 75-100 kDa GenBank Accession Number: . Gene Symbol: VWF Gene ID (NCBI): 7450 RRID: AB_10642840 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04275 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.