Proteintech, 11781-1-AP, IgG Kappa Light Chain Polyclonal antibody

Size: 20ul / 150ul The IgG Kappa Light Chain (11781-1-AP) by Proteintech is a Polyclonal antibody targeting IgG Kappa Light Chain in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 11781-1-AP targets IgG Kappa Light Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma tissue, A549 cells, K-562 cells, mouse spleen tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information This antibody detects the kappa light chain of human IgG. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2406 Product name: Recombinant human IGKV1-5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC030814 Sequence: MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSDGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGIYYCMQGLQTPQTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNTLQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Predict reactive species Full Name: immunoglobulin kappa variable 1-5 Calculated Molecular Weight: 239 aa, 26 kDa Observed Molecular Weight: 26 kDa, 13 kDa GenBank Accession Number: BC030814 Gene Symbol: IgG Kappa Light Chain Gene ID (NCBI): 28299 RRID: AB_10953529 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.