Proteintech, 11795-1-AP, TPD52L2 Polyclonal antibody

Size: 20ul / 150ul The TPD52L2 (11795-1-AP) by Proteintech is a Polyclonal antibody targeting TPD52L2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11795-1-AP targets TPD52L2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, rat brain tissue, MCF-7 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Tumor protein D52-like proteins (TPD52) are small coiled-coil motif bearing proteins that were first identified in breast carcinoma. Three human TPD52 members had been identified, named hD52 (TPD52), hD53 (TPD52L1), and hD54 (TPD52L2). The most important characteristic of the protein family is a highly conserved coiled-coil motif that is required for homo- and heteromeric interaction with other TPD52-like proteins. TPD52 and related proteins have been implicated in cell proliferation, apoptosis, and vesicle trafficking. TPD52L2 has five isoforms produced by alternative splicing, and its multiple sites have been identified to be phosphorylated. Interaction of TPD52L2 with MAL2, a novel member of the MAL proteolipid family, may be required for the role of TPD52L2 in vesicle transport. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2364 Product name: Recombinant human TPD52L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC006804 Sequence: MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLS Predict reactive species Full Name: tumor protein D52-like 2 Calculated Molecular Weight: 206 aa, 22 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC006804 Gene Symbol: TPD52L2 Gene ID (NCBI): 7165 RRID: AB_2207431 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43399 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.