Proteintech, 11815-1-AP, NOLC1 Polyclonal antibody

Size: 20ul / 150ul The NOLC1 (11815-1-AP) by Proteintech is a Polyclonal antibody targeting NOLC1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 11815-1-AP targets NOLC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Nucleolar and coiled-body phosphoprotein 1 (NOLC1) is a phosphoprotein that transiently associates with the mature nucleolar H/ACA and C/D box small nucleolar ribonucleoproteins (snoRNPs), guiding site-specific 2'-O-meth-ylation and pseudouridylation of pre-rRNAs [PMID:21266110]. It contains a nuclear localization signal binding sequence and is thought to shuttle between the nucleolus and the cytoplasm. NOLC1 plays an essential role in the synthesis of rRNA and the biosynthesis of ribosomes [PMID:8972203]. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2382 Product name: Recombinant human P130 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-418 aa of BC006769 Sequence: TKPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE Predict reactive species Full Name: nucleolar and coiled-body phosphoprotein 1 Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC006769 Gene Symbol: NOLC1 Gene ID (NCBI): 9221 RRID: AB_2235983 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14978 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.