Proteintech, 11871-1-AP, SH2D1B Polyclonal antibody

Size: 20ul / 150ul The SH2D1B (11871-1-AP) by Proteintech is a Polyclonal antibody targeting SH2D1B in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11871-1-AP targets SH2D1B in IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SH2D1B, also named as EAT2, an adaptor expressed in innate immune cells, including natural killer (NK) cells. It plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells. EAT-2 overexpression would enhance the innate immune responses and also result in more potent Carcinoembryonic antigen-specific adaptive immune responses. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2454 Product name: Recombinant human SH2D1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC022407 Sequence: MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP Predict reactive species Full Name: SH2 domain containing 1B Calculated Molecular Weight: 132 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC022407 Gene Symbol: SH2D1B Gene ID (NCBI): 117157 RRID: AB_10603473 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.