Proteintech, 12080-1-AP, B7‑H4 Polyclonal antibody

Size: 20ul / 150ul The B7‑H4 (12080-1-AP) by Proteintech is a Polyclonal antibody targeting B7‑H4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12080-1-AP targets B7‑H4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, A549 cells, rat liver tissue Positive IHC detected in: human ovary tumor tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information B7‑H4 also named VTCN1, B7X, or B7S1 is a 282 amino acid protein, which contains 2 immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7‑H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7‑H4 is a single-pass type I membrane protein, which is over-expressed in breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2712 Product name: Recombinant human VTCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC065717 Sequence: MFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK Predict reactive species Full Name: V-set domain containing T cell activation inhibitor 1 Calculated Molecular Weight: 282 aa, 31 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC065717 Gene Symbol: B7-H4 Gene ID (NCBI): 79679 RRID: AB_2877822 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z7D3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.