Proteintech, 12106-1-AP, PTMS Polyclonal antibody

Size: 20ul / 150ul The PTMS (12106-1-AP) by Proteintech is a Polyclonal antibody targeting PTMS in WB, IF/ICC, ELISA applications with reactivity to human samples 12106-1-AP targets PTMS in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PTMS, also named as Parathymosin, is a small nuclear protein that can physically interact with glucocorticoid receptors (GR) and histone H1, respectively, and can serve as a coactivator of GR (PMID: 16150697; PMID: 15716277). It is widely distributed in mammalian tissues. Catalog#12106-1-AP is a rabbit polyclonal antibody raised against the full-length of human PTMS. The MW of this protein is 12 kDa, and this antibody specially recognises the 12 kDa protein. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2751 Product name: Recombinant human PTMS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC017025 Sequence: MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA Predict reactive species Full Name: parathymosin Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC017025 Gene Symbol: PTMS Gene ID (NCBI): 5763 RRID: AB_10665368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20962 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.