Proteintech, 12118-1-AP, ETS1 Polyclonal antibody

Size: 20ul / 150ul The ETS1 (12118-1-AP) by Proteintech is a Polyclonal antibody targeting ETS1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12118-1-AP targets ETS1 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse thymus tissue, Raji cells Positive IHC detected in: rat spleen tissue, mouse spleen tissue, rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ETS1 is a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. ETS1 is a nuclear protein and primarily acts as a transcriptional activator, though it can also repress gene transcription. Since it is primarily expressed in lymphocytes, it plays several critical roles in immunity. In addition, it is important for angiogenesis. Since cells express several Ets proteins at the same time, functional redundancy is possible. This is particularly shown for the socalled housekeeping genes where several Ets factors were found to occupy the proximal promoters in vivo. The ETS1 protein exists as three isoforms: ETS1-p51, ETS1-p42, ETS1-p27 ranging in size from 27 to 51 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2127 Product name: Recombinant human ETS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-272 aa of BC017314 Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT Predict reactive species Full Name: v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) Calculated Molecular Weight: 441 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC017314 Gene Symbol: ETS1 Gene ID (NCBI): 2113 RRID: AB_10664925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14921 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.