Proteintech, 12142-1-AP, OIP5 Polyclonal antibody

Size: 20ul / 150ul The OIP5 (12142-1-AP) by Proteintech is a Polyclonal antibody targeting OIP5 in WB, IP, ELISA applications with reactivity to human samples 12142-1-AP targets OIP5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information OIP5 is also known as Mis18β. Vertebrates possess two Mis18 paralogs, Mis18α and Mis18β. Mis18 has been previously shown to affect histone modifications and the methylation status of underlying chromatin . Eliminating histone methylation within the alpha satellite DNA repeats of a human artificial chromosome alters the recruitment of HJURP .The Mis18core complex was originally characterized as an oligomer with a proposed 2:2 stoichiometry of Mis18α and Mis18β, but additional work demonstrated a 4:2 Mis18α:Mis18β hexamer. (PMID: 31492860, PMID: 26942680) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2790 Product name: Recombinant human OIP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC015050 Sequence: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN Predict reactive species Full Name: Opa interacting protein 5 Calculated Molecular Weight: 229 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC015050 Gene Symbol: OIP5 Gene ID (NCBI): 11339 RRID: AB_2157076 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43482 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.