Proteintech, 12160-1-AP, PAR2 Polyclonal antibody

Size: 20ul / 150ul The PAR2 (12160-1-AP) by Proteintech is a Polyclonal antibody targeting PAR2 in WB, ELISA applications with reactivity to human samples 12160-1-AP targets PAR2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, DU 145 cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Proteinase-activated receptors (PARs) are G protein-coupled receptors activated through cleavage of their N-termini by mainly serine proteases. The family of PARs includes four members: PAR1, PAR2, PAR3, and PAR4. PAR2, also known as F2RL1, is expressed in epithelial cells (e.g., lung, gastrointestinal tract), endothelial cells, smooth muscle cells, fibroblasts, nerves, and some immune and inflammatory cells. PAR2 knockout mice and PAR2 agonists and antagonists have implicated PAR2 as a promising target in inflammatory conditions; respiratory, gastrointestinal, metabolic, cardiovascular, and neurological dysfunction; and cancers. (PMID:23895492) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2801 Product name: Recombinant human F2RL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-87 aa of BC018130 Sequence: LLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFV Predict reactive species Full Name: coagulation factor II (thrombin) receptor-like 1 Calculated Molecular Weight: 397 aa, 44 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC018130 Gene Symbol: PAR2 Gene ID (NCBI): 2150 RRID: AB_10598009 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55085 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.