Proteintech, 12245-1-AP, Cystatin C Polyclonal antibody

Size: 20ul / 150ul The Cystatin C (12245-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin C in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 12245-1-AP targets Cystatin C in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, fetal human brain tissue, HepG2 cells, human milk, HeLa cells, U-87 MG cells, U2OS cells, human urine, human serum, mouse brain tissue Positive IP detected in: Caco-2 cells Positive IHC detected in: mouse kidney tissue, human kidney tissue, human ovary tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2890 Product name: Recombinant human Cystatin C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-146 aa of BC013083 Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Predict reactive species Full Name: cystatin C Calculated Molecular Weight: 146 aa, 16 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC013083 Gene Symbol: Cystatin C Gene ID (NCBI): 1471 RRID: AB_2088058 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01034 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.