Proteintech, 12277-1-AP, SLC25A46 Polyclonal antibody

Size: 20ul / 150ul The SLC25A46 (12277-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A46 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12277-1-AP targets SLC25A46 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse brain tissue, rat brain tissue, MCF-7 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2923 Product name: Recombinant human SLC25A46 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC017169 Sequence: MHPRRPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQSSEQLNRFAGFGIGLASLFTENVLAHPCIVLRRQCQVNYHAQHYHLTPFTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGIISEFTPLPREVLHKWSPKQIGEHLLLKSLTYVVAMPFYSASLIETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSL Predict reactive species Full Name: solute carrier family 25, member 46 Calculated Molecular Weight: 418 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC017169 Gene Symbol: SLC25A46 Gene ID (NCBI): 91137 RRID: AB_2239384 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AG3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.