Proteintech, 12279-1-AP, SEMA4G Polyclonal antibody

Size: 20ul / 150ul The SEMA4G (12279-1-AP) by Proteintech is a Polyclonal antibody targeting SEMA4G in WB, ELISA applications with reactivity to human samples 12279-1-AP targets SEMA4G in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, SH-SY5Y cells, SW480 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Semaphorins constitute a large and growing gene family, several members of which are axon guidance molecules. SEMA4G, a novel class IV member of the semaphorin gene family, located on mouse chromosome 19. SEMA4G is expressed early in development in the brain, spinal cord, and several sensory organs as well as specific populations of projection neurons, compatible with the well-established function of semaphorins as axon guidance molecules. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2928 Product name: Recombinant human SEMA4G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC020960 Sequence: MGSMSPPSAWPCVLDGPETRQDLCQPPKPCVHSHAHMEECLSAGLQCPHPHLLLVHSCFIPASGLGVPSQLPHPIWSSSPAPCGDLFVKSLGTGQPGEVRLHHSPPLPSCVALVNQPPHSPWSFSRV Predict reactive species Full Name: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G Calculated Molecular Weight: 91 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC020960 Gene Symbol: SEMA4G Gene ID (NCBI): 57715 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NTN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.