Proteintech, 12287-1-AP, CIDEC Polyclonal antibody

Size: 20ul / 150ul The CIDEC (12287-1-AP) by Proteintech is a Polyclonal antibody targeting CIDEC in WB, ELISA applications with reactivity to human samples 12287-1-AP targets CIDEC in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cell death-inducing DFF45-like effector (CIDE) proteins, including CIDEA, CIDEB and CIDEC (also called Fsp27 in rodents), are predominantly expressed in brown adipose tissues (BAT), liver and WAT. CIDEC was found to be highly expressed in adipose tissues and to function as a lipid droplet-binding protein that promotes lipid accumulation in adipocytes. While normal mouse livers express low levels of CIDEC protein, its expression is highly upregulated in NALFD, but not in chronic ethanol feeding-induced fatty liver. (PMID: 26099526) Catalog#12287-1-AP recognizing CIDEC (calculated 28 kDa) as a 30 kDa and 45-50 kDa due to its posttranslational modification (PMID: 19258494). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2913 Product name: Recombinant human CIDEC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC016851 Sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ Predict reactive species Full Name: cell death-inducing DFFA-like effector c Calculated Molecular Weight: 238 aa, 27 kDa Observed Molecular Weight: 27-35 kDa GenBank Accession Number: BC016851 Gene Symbol: CIDEC Gene ID (NCBI): 63924 RRID: AB_2877842 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AQ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.