Proteintech, 12292-1-AP, ALKBH3 Polyclonal antibody

Size: 20ul / 150ul The ALKBH3 (12292-1-AP) by Proteintech is a Polyclonal antibody targeting ALKBH3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12292-1-AP targets ALKBH3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse kidney tissue, mouse heart tissue, rat heart tissue Positive IHC detected in: human lung cancer tissue, human testis tissue, human prostate cancer tissue, human pancreas cancer tissue, rat stomach tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:2000 Background Information ALKBH3, also named as ABH3 and DEPC-1, is a dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). It has a strong preference for single-stranded. ALKBH3 is requires molecular oxygen, alpha-ketoglutarate and iron. This gene has some isoforms with MW 19-25 kDa and 33 kDa. It is possible that there is ubiquitination modification (PMID: 25944111). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2982 Product name: Recombinant human ALKBH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-286 aa of BC015155 Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW Predict reactive species Full Name: alkB, alkylation repair homolog 3 (E. coli) Calculated Molecular Weight: 286 aa, 33 kDa Observed Molecular Weight: 22-25 kDa, 33kDa GenBank Accession Number: BC015155 Gene Symbol: ALKBH3 Gene ID (NCBI): 221120 RRID: AB_11125161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96Q83 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.