Proteintech, 12358-1-AP, NDUFB3 Polyclonal antibody

Size: 20ul / 150ul The NDUFB3 (12358-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12358-1-AP targets NDUFB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human heart tissue, mouse heart tissue, rat heart tissue Positive IHC detected in: human liver cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NDUFB3(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3) is also named as CI-B12 and belongs to the complex I NDUFB3 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3022 Product name: Recombinant human NDUFB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC018183 Sequence: MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa Calculated Molecular Weight: 98 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC018183 Gene Symbol: NDUFB3 Gene ID (NCBI): 4709 RRID: AB_2282633 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43676 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.