Iright
BRAND / VENDOR: Proteintech

Proteintech, 12368-1-AP, PINX1 Polyclonal antibody

CATALOG NUMBER: 12368-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PINX1 (12368-1-AP) by Proteintech is a Polyclonal antibody targeting PINX1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12368-1-AP targets PINX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, A431 cells, C6 cells, NIH/3T3 cells, HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PINX1, also named as LPTL, LPTS and Protein 67-11-3, is a Liver-related putative tumor suppressor. It belongs to the PINX1 family. PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. It mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. PINX1 inhibits telomerase activity. It may inhibit cell proliferation and act as tumor suppressor. PINX1 has been identified as a critical telomerase inhibitor and proposed to be a putative tumor suppressor gene. Loss of PinX1 has been found in a large variety of malignancies, but the expression status in epithelial ovarian tumors has not been investigated. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3043 Product name: Recombinant human PINX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-328 aa of BC015479 Sequence: MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK Predict reactive species Full Name: PIN2-interacting protein 1 Calculated Molecular Weight: 328 aa, 37 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC015479 Gene Symbol: PINX1 Gene ID (NCBI): 54984 RRID: AB_2164405 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BK5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924