Proteintech, 12369-1-AP, Sortilin Polyclonal antibody

Size: 20ul / 150ul The Sortilin (12369-1-AP) by Proteintech is a Polyclonal antibody targeting Sortilin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 12369-1-AP targets Sortilin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: mouse brain tissue, human brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2997 Product name: Recombinant human SORT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 481-831 aa of BC023542 Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE Predict reactive species Full Name: sortilin 1 Calculated Molecular Weight: 831 aa, 92 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC023542 Gene Symbol: Sortilin Gene ID (NCBI): 6272 ENSEMBL Gene ID: ENSG00000134243 RRID: AB_2302242 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99523 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.