Proteintech, 12587-1-AP, PDCD4 Polyclonal antibody

Size: 20ul / 150ul The PDCD4 (12587-1-AP) by Proteintech is a Polyclonal antibody targeting PDCD4 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 12587-1-AP targets PDCD4 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, MCF-7 cells, HEK293 cells, HEK-293 cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Programmed cell death 4 (Pdcd4) is a novel tumor suppressor that inhibits translation, progression and invasion. It was first identified as being differnetially upregulated during apoptosis. Pdcd4 interferes with the activity of the eukaryotic initiation factor (eIF) 4A by displacing the scaffold protein eIF4G from its binding to the RNA helicase eIF4A. The calculated molecular wight of unmodified PDCD4 protein is 52 kDa, but the modified protein is about 54-64 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3288 Product name: Recombinant human PDCD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 169-469 aa of BC026104 Sequence: TPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY Predict reactive species Full Name: programmed cell death 4 (neoplastic transformation inhibitor) Calculated Molecular Weight: 469 aa, 52 kDa Observed Molecular Weight: 54-64 kDa GenBank Accession Number: BC026104 Gene Symbol: PDCD4 Gene ID (NCBI): 27250 RRID: AB_2162296 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53EL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.