Proteintech, 12596-1-AP, OLFM3 Polyclonal antibody

Size: 20ul / 150ul The OLFM3 (12596-1-AP) by Proteintech is a Polyclonal antibody targeting OLFM3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12596-1-AP targets OLFM3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, A2780 cells, human liver tissue, mouse liver tissue, NIH/3T3 cells Positive IHC detected in: mouse brain tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information OLFM3, also known as Noelin-3, belongs to a larger family of proteins containing the olfactomedin domain. OLFM3, which is most closely related to OLFM2, is expressed in the retinal ganglion and inner nuclear layers of the adult rat retina (PMID: 12019210). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3207 Product name: Recombinant human OLFM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-458 aa of BC022531 Sequence: NLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPVTVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDMGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALCAWNNGHQVLFNVTLFHIIKTEDDT Predict reactive species Full Name: olfactomedin 3 Calculated Molecular Weight: 458 aa, 53 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC022531 Gene Symbol: OLFM3 Gene ID (NCBI): 118427 RRID: AB_2157228 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.